DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Hck

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_037317.2 Gene:Hck / 25734 RGDID:2785 Length:524 Species:Rattus norvegicus


Alignment Length:420 Identity:152/420 - (36%)
Similarity:227/420 - (54%) Gaps:62/420 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   931 LSMKDHCYCVPS--LAASISLSTNRPLYEEEWFHGVLPREEVVRLL----NNDGDFLVRE----- 984
            |:.|...| :||  :|...||.|      ||||...:.|::..|.|    |..|.|::|:     
  Rat   118 LATKKEGY-IPSNYVARVNSLET------EEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTK 175

  Fly   985 -----TIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEGP--PFASIQELIMH---------QY 1033
                 ::|:.:.|...:|     ||:.::|...|.| :..|  .|:|:|||::|         |.
  Rat   176 GSYSLSVRDFDPQHGDTV-----KHYKIRTLDSGGF-YISPRSTFSSLQELVVHYKKGKDGLCQK 234

  Fly  1034 HSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKL-KSTKLDVAVKTCRMT 1097
            .|...|:.|.    ::|..::.||:..:.:.:.:::|.|.||:|:.|.. |.||  |||||.:  
  Rat   235 LSVPCVSPKP----QKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTK--VAVKTMK-- 291

  Fly  1098 LPDEQK-RKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQ 1161
             |.... ..||.|..::|...|..:|||..: |.::||.||.|.:..||||.:| |:..|  ::|
  Rat   292 -PGSMSVEAFLAEANLMKTLQHDKLVKLHAV-VSQEPIFIVTEFMAKGSLLDFL-KSEEG--SKQ 351

  Fly  1162 QMGMCRDAAA----GMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR--EEEEYIVSDGMK 1220
            .:....|.:|    ||.::|.:|.|||||.|.|.||......||:|||::|  |:.||...:|.|
  Rat   352 PLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAK 416

  Fly  1221 QIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKST 1285
             .|:|||||||:|||.:|...||||:|||:.||.:.|..||.||:|......::.|||||.|.:.
  Rat   417 -FPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC 480

  Fly  1286 PEEMYRLMLQCWAADAESRPHFDEIYNVVD 1315
            |||:|.:|::||....|.||.|:.|.:|:|
  Rat   481 PEELYSIMIRCWKNRPEERPTFEYIQSVLD 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 28/110 (25%)
TyrKc 1063..1311 CDD:197581 107/255 (42%)
PTKc_Fes_like 1067..1315 CDD:270637 109/255 (43%)
HckNP_037317.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..71
SH3 80..135 CDD:302595 6/17 (35%)
SH2_Src_HCK 138..241 CDD:198226 29/114 (25%)
PKc_like 252..522 CDD:304357 112/269 (42%)
Pkinase_Tyr 260..509 CDD:285015 108/258 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.