DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Jak3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_036987.2 Gene:Jak3 / 25326 RGDID:2940 Length:1100 Species:Rattus norvegicus


Alignment Length:288 Identity:95/288 - (32%)
Similarity:148/288 - (51%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1061 DDVVLLER-------IGRGNFGDV----YKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILK 1114
            |..:..||       :|:||||.|    |.....:|...||||..:.:.| ||:|.|.:|.:|||
  Rat   809 DPAIFEERHLKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGP-EQQRDFQREIQILK 872

  Fly  1115 QYDHPNIVKLIGICV--QKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLE 1177
            ......|||..|:..  .:|.:.:|||.:..|.|..:|:::...|...:.:........||.||.
  Rat   873 ALHCDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHNDRLLLFAWQICKGMEYLG 937

  Fly  1178 SKNCIHRDLAARNCLVDLEHSVKISDFGMSR----EEEEYIVSDGMKQIPVKWTAPEALNFGKYT 1238
            ::.|:||||||||.||:.|..|||:|||:::    .::.|:|.: ..|.|:.|.|||:|:...::
  Rat   938 ARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVRE-PGQSPIFWYAPESLSDNIFS 1001

  Fly  1239 SLCDVWSYGILMWEIFSKGDTPYSGMTN--------------SRARERIDTGYRMPTPKSTPEEM 1289
            ...||||:|::::|:|:..|...|..|.              ....|.:..|.|:|.|.:.|.|:
  Rat  1002 RQSDVWSFGVVLYELFTYSDKSCSPSTEFLRMMGPEREGSPLCHLLELLAEGRRLPPPSTCPTEV 1066

  Fly  1290 YRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            ..||..||:.:.:.||.||.:...:|||
  Rat  1067 QELMQLCWSPNPQDRPAFDTLSPQLDAL 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 91/278 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 91/278 (33%)
Jak3NP_036987.2 cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..223
FERM_F1 41..114 CDD:408179
FERM_F2 126..245 CDD:408177
FERM_C_JAK3 250..359 CDD:275413
SH2 359..455 CDD:417686
PKc_like 517..774 CDD:419665
PKc_like 813..1095 CDD:419665 94/284 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.