DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Fgfr2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_036844.1 Gene:Fgfr2 / 25022 RGDID:2611 Length:841 Species:Rattus norvegicus


Alignment Length:437 Identity:125/437 - (28%)
Similarity:191/437 - (43%) Gaps:70/437 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   921 EEEDSASDDVLSMKDHCYCVPSLAASI--------SLSTNRPLYEEE-WFHGVLPREEVVRLLNN 976
            |:|.:||.|.|.:..:|..|..:|..:        ..:|.:|.:..: ..|.:..|..:.|    
  Rat   386 EKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMKTTTKKPDFSSQPAVHKLTKRIPLRR---- 446

  Fly   977 DGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTV 1041
                  :.|:..|.|..:.|      ...:|:.|...:...:.|..|.:.|.       |||...
  Rat   447 ------QVTVSAESSSSMNS------NTPLVRITTRLSSTADTPMLAGVSEY-------ELPEDP 492

  Fly  1042 KSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLD-------VAVKTCRMTLP 1099
            |             ||...|.:.|.:.:|.|.||.|..|:......|       ||||..:....
  Rat   493 K-------------WEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTVAVKMLKDDAT 544

  Fly  1100 DEQKRKFLQEGRILKQY-DHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKN---------- 1153
            ::.....:.|..::|.. .|.||:.|:|.|.|..|:.:::|....|:|..|||..          
  Rat   545 EKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYD 609

  Fly  1154 -----SNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EE 1211
                 ...:|.:..:......|.||.||.|:.||||||||||.||...:.:||:|||::|:  ..
  Rat   610 INRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNI 674

  Fly  1212 EYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTG 1276
            :|.......::||||.|||||....||...||||:|:||||||:.|.:||.|:......:.:..|
  Rat   675 DYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG 739

  Fly  1277 YRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRLDN 1323
            :||..|.:...|:|.:|..||.|....||.|.::...:|.::....|
  Rat   740 HRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 15/86 (17%)
TyrKc 1063..1311 CDD:197581 93/272 (34%)
PTKc_Fes_like 1067..1315 CDD:270637 92/272 (34%)
Fgfr2NP_036844.1 Ig 50..143 CDD:416386
Ig strand A 50..53 CDD:409353
Ig strand A' 66..72 CDD:409353
Ig strand B 75..85 CDD:409353
Ig strand C 88..93 CDD:409353
Ig strand C' 96..98 CDD:409353
Ig strand D 103..107 CDD:409353
Ig strand E 110..115 CDD:409353
Ig strand F 121..130 CDD:409353
Ig strand G 133..143 CDD:409353
IgI_2_FGFR 173..267 CDD:409443
Ig strand B 194..198 CDD:409443
Ig strand C 207..211 CDD:409443
Ig strand E 233..237 CDD:409443
Ig strand F 247..252 CDD:409443
Ig strand G 260..263 CDD:409443
Ig 275..377 CDD:416386
Ig strand A 275..278 CDD:409353
Ig strand A' 282..286 CDD:409353
Ig strand B 294..301 CDD:409353
Ig strand C 305..312 CDD:409353
Ig strand D 327..332 CDD:409353
Ig strand E 342..347 CDD:409353
Ig strand F 355..363 CDD:409353
Ig strand G 366..374 CDD:409353
FGFR3_TM 391..421 CDD:407957 7/29 (24%)
PTKc_FGFR2 476..788 CDD:270679 105/331 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.