DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Jak2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_113702.1 Gene:Jak2 / 24514 RGDID:2939 Length:1132 Species:Rattus norvegicus


Alignment Length:294 Identity:94/294 - (31%)
Similarity:154/294 - (52%) Gaps:32/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1053 RERWELSNDDVVLLERIGRGNFGDV----YKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRIL 1113
            |:..:.....:..|:::|:||||.|    |.....:|...||||..:.: .:|..|.|.:|..||
  Rat   839 RDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHS-TEEHLRDFEREIEIL 902

  Fly  1114 KQYDHPNIVKLIGICVQ--KQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYL 1176
            |...|.||||..|:|..  ::.:.::||.:..|||..||:|:...:..::.:........||.||
  Rat   903 KSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYL 967

  Fly  1177 ESKNCIHRDLAARNCLVDLEHSVKISDFGMSR---EEEEYIVSDGMKQIPVKWTAPEALNFGKYT 1238
            .:|..||||||.||.||:.|:.|||.|||:::   :::||.......:.|:.|.|||:|...|::
  Rat   968 GTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFS 1032

  Fly  1239 SLCDVWSYGILMWEIFS---KGDTP---YSGMTNSRAR---------ERIDTGYRMPTPKSTPEE 1288
            ...||||:|::::|:|:   |..:|   :..|..:..:         |.:....|:|.|:..|:|
  Rat  1033 VASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPEGCPDE 1097

  Fly  1289 MYRLMLQCWAADAESRPHFDEIYNVVDALILRLD 1322
            :|.:|.:||..:...||.|.:       |.||:|
  Rat  1098 IYVIMTECWNNNVNQRPSFRD-------LSLRVD 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 89/271 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 88/271 (32%)
Jak2NP_113702.1 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..239
FERM_F1 39..134 CDD:408179
FERM_F2 143..261 CDD:408177
FERM_C_JAK2 266..386 CDD:270141
SH2_Jak2 386..482 CDD:198242
PTK_Jak2_rpt1 545..806 CDD:270663
PTKc_Jak2_rpt2 844..1127 CDD:271107 93/289 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.