DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and FGFR2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_006717771.1 Gene:FGFR2 / 2263 HGNCID:3689 Length:839 Species:Homo sapiens


Alignment Length:444 Identity:125/444 - (28%)
Similarity:192/444 - (43%) Gaps:86/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   921 EEEDSASDDVLSMKDHC---YCVPSLAASISL-----STNRPLYEEE-WFHGVLPREEVVRLLN- 975
            |:|.:||.|.|.:..:|   :.:..:..::.|     :|.:|.:..: ..|.:..|..:.|.:: 
Human   386 EKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSA 450

  Fly   976 ------NDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEGPPFASIQELIMHQYH 1034
                  |....|||.|.|                   :.:|.      :.|..|.:.|.      
Human   451 ESSSSMNSNTPLVRITTR-------------------LSSTA------DTPMLAGVSEY------ 484

  Fly  1035 SELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLD-------VAVK 1092
             |||...|             ||...|.:.|.:.:|.|.||.|..|:......|       ||||
Human   485 -ELPEDPK-------------WEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVK 535

  Fly  1093 TCRMTLPDEQKRKFLQEGRILKQY-DHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKN--- 1153
            ..:....::.....:.|..::|.. .|.||:.|:|.|.|..|:.:::|....|:|..|||..   
Human   536 MLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPP 600

  Fly  1154 ------------SNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGM 1206
                        ...:|.:..:......|.||.||.|:.||||||||||.||...:.:||:|||:
Human   601 GMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGL 665

  Fly  1207 SRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRA 1269
            :|:  ..:|.......::||||.|||||....||...||||:|:||||||:.|.:||.|:.....
Human   666 ARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEEL 730

  Fly  1270 RERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRLDN 1323
            .:.:..|:||..|.:...|:|.:|..||.|....||.|.::...:|.::....|
Human   731 FKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 16/93 (17%)
TyrKc 1063..1311 CDD:197581 93/272 (34%)
PTKc_Fes_like 1067..1315 CDD:270637 92/272 (34%)
FGFR2XP_006717771.1 Ig1_FGFR 66..143 CDD:143174
IG_like 66..143 CDD:214653
Ig2_FGFR 183..267 CDD:143265
IG_like 282..376 CDD:214653
Ig3_FGFR 290..377 CDD:143175
PTKc_FGFR2 474..786 CDD:270679 105/331 (32%)
Pkinase_Tyr 499..775 CDD:285015 93/275 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.