DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and FGFR3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_006713931.1 Gene:FGFR3 / 2261 HGNCID:3690 Length:811 Species:Homo sapiens


Alignment Length:326 Identity:108/326 - (33%)
Similarity:161/326 - (49%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 EGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKA-- 1080
            |||..|::.||       |||...|             ||||...:.|.:.:|.|.||.|..|  
Human   451 EGPTLANVSEL-------ELPADPK-------------WELSRARLTLGKPLGEGCFGQVVMAEA 495

  Fly  1081 ----KLKSTK-LDVAVKTCRMTLPDEQKRKFLQEGRILKQY-DHPNIVKLIGICVQKQPIMIVME 1139
                |.::.| :.||||..:....|:.....:.|..::|.. .|.||:.|:|.|.|..|:.:::|
Human   496 IGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVE 560

  Fly  1140 LVLGGSLLTYLRKN---------------SNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAAR 1189
            ....|:|..:||..               ...||.:..:......|.||.||.|:.|||||||||
Human   561 YAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAAR 625

  Fly  1190 NCLVDLEHSVKISDFGMSREEE--EYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWE 1252
            |.||..::.:||:|||::|:..  :|.......::||||.|||||....||...||||:|:|:||
Human   626 NVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWE 690

  Fly  1253 IFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            ||:.|.:||.|:......:.:..|:||..|.:...::|.:|.:||.|....||.|.::...:|.:
Human   691 IFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRV 755

  Fly  1318 I 1318
            :
Human   756 L 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 8/20 (40%)
TyrKc 1063..1311 CDD:197581 93/272 (34%)
PTKc_Fes_like 1067..1315 CDD:270637 92/272 (34%)
FGFR3XP_006713931.1 IGc2 53..110 CDD:197706
IG 54..125 CDD:214652
Ig2_FGFR 161..245 CDD:143265
IG_like 171..245 CDD:214653
IG_like 260..355 CDD:214653
Ig3_FGFR 268..356 CDD:143175
PKc_like 463..797 CDD:304357 101/307 (33%)
Pkinase_Tyr 476..752 CDD:285015 93/275 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.