DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Txk

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_036020891.1 Gene:Txk / 22165 MGIID:102960 Length:543 Species:Mus musculus


Alignment Length:592 Identity:176/592 - (29%)
Similarity:266/592 - (44%) Gaps:137/592 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 SNHSASQSTII-----TSTITTTITTTTTTTPSKENSRLKFKVPKIQKKSKAIRNTFRSKLLNFQ 833
            |::|:.||.:.     .|.....:.|..:.:..:|.|         :|.|:..|..| :||:.  
Mouse    33 SSYSSFQSVLCCCCCRCSVQKRQVRTQISLSREEELS---------EKHSQRQRPWF-AKLMG-- 85

  Fly   834 LKRSKPCKQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKD 898
                   |..:.|..:.|||           .:|           .||..|:|....:|:....|
Mouse    86 -------KTQSNRGGVQPSK-----------RKP-----------LPPLPQEPPDERIQVKALYD 121

  Fly   899 H-PFESSSGELD--------ENSD------RDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASIS 948
            . |.|..:..|.        |..|      ||...:|.                 .:||...:.:
Mouse   122 FLPREPGNLALKRAEEYLILERCDPHWWKARDRFGNEG-----------------LIPSNYVTEN 169

  Fly   949 LSTNRPLYEEEWFHGVLPREEVVRLLN---NDGDFLVRE-------TI-------RNEESQIVLS 996
            ...|..:|  ||:|..:.|.:..|||.   .:|.|:||:       ||       |:.:|.|   
Mouse   170 RLANLEIY--EWYHKNITRNQTERLLRQEAKEGAFIVRDSRHLGSYTISVFTRARRHTQSSI--- 229

  Fly   997 VCWNGHKHFIVQTTGEGNFRF-EGPPFASIQELIM-HQYHSELPVTVKSGAI--LRRPV-----C 1052
                  ||:.::....|.:.. |...|.|:.|||. |||::       :|.|  ||.|:     |
Mouse   230 ------KHYQIKKNDSGQWYITERHLFPSVPELIQYHQYNA-------AGLISRLRYPIGLLGSC 281

  Fly  1053 --------RERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQE 1109
                    .|:||:...::..::.||.|.||.|:..:.:: .:.||:|........|:  .|::|
Mouse   282 LPATSGFSYEKWEIDPSELAFVKEIGSGQFGVVHLGEWRA-HIPVAIKAINEGSMSEE--DFIEE 343

  Fly  1110 GRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMR 1174
            .:::.:..|..:|:|.|:|:|::|:.||.|.:..|.||.|||:....|.....:.||:|...||.
Mouse   344 AKVMMKLSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLDYLRERKGQLQKALLLSMCQDICEGMA 408

  Fly  1175 YLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALNFGKY 1237
            |||....||||||||||||.....||||||||:|.  ::|||.|.|.| .||||..||..:|.||
Mouse   409 YLERSCYIHRDLAARNCLVSSACVVKISDFGMARYVLDDEYISSSGAK-FPVKWCPPEVFHFNKY 472

  Fly  1238 TSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAE 1302
            :|..||||:|:||||:|::|..|:...:|.:..|.|..|:|:..|...|..:||:|..|| .:..
Mouse   473 SSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISQGFRLYRPHLAPMTIYRVMYSCW-HETL 536

  Fly  1303 SRPHFDE 1309
            .:|.|.|
Mouse   537 QKPVFQE 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 29/104 (28%)
TyrKc 1063..1311 CDD:197581 101/249 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 101/245 (41%)
TxkXP_036020891.1 SH3_TXK 114..168 CDD:212840 12/70 (17%)
SH2_Tec_Txk 172..277 CDD:198261 35/122 (29%)
PKc_like 295..543 CDD:419665 100/252 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.