DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and PTK2B

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_004094.3 Gene:PTK2B / 2185 HGNCID:9612 Length:1009 Species:Homo sapiens


Alignment Length:282 Identity:111/282 - (39%)
Similarity:163/282 - (57%) Gaps:13/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1034 HSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYK---AKLKSTKLDVAVKTCR 1095
            ::|:|     ...|||| ...::.::.:||||...:|.|.||:||:   ...|..|::||||||:
Human   402 YAEIP-----DETLRRP-GGPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCK 460

  Fly  1096 MTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTR 1160
            .....:.|.||:.|..|:|..|||:||||||| ::::|..|:|||...|.|..||.:|.|.|...
Human   461 KDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGI-IEEEPTWIIMELYPYGELGHYLERNKNSLKVL 524

  Fly  1161 QQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR--EEEEYIVSDGMKQIP 1223
            ..:.........|.||||.||:|||:|.||.||.....||:.|||:||  |:|:|..: .:.::|
Human   525 TLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKA-SVTRLP 588

  Fly  1224 VKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEE 1288
            :||.:||::||.::|:..|||.:.:.||||.|.|..|:..:.|......::.|.|:|.|...|..
Human   589 IKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPV 653

  Fly  1289 MYRLMLQCWAADAESRPHFDEI 1310
            :|.||.:||..|...||.|.|:
Human   654 LYTLMTRCWDYDPSDRPRFTEL 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 1/4 (25%)
TyrKc 1063..1311 CDD:197581 104/253 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 101/249 (41%)
PTK2BNP_004094.3 B41 41..254 CDD:214604
FERM_B-lobe 150..254 CDD:271216
FERM_C_FAK1 261..368 CDD:270011
PTKc_FAK 418..687 CDD:133187 105/260 (40%)
TyrKc 425..679 CDD:197581 104/253 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 701..725
Interaction with TGFB1I1. /evidence=ECO:0000250 801..1009
Focal adhesion targeting (FAT) 868..1009
Focal_AT 872..1001 CDD:281606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.