DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Pstpip2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_038859.3 Gene:Pstpip2 / 19201 MGIID:1335088 Length:334 Species:Mus musculus


Alignment Length:268 Identity:59/268 - (22%)
Similarity:102/268 - (38%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RLMETMKRSIQMKAKCDKEYAISLTAVAQQGLKIDRADEMQGSLISKSWRSYMDELDHQAK-QFK 88
            |.:|..|:.:...|:|..:.|.:|   .::..|::...|.| .|..|...:.||....|.. |||
Mouse    75 RALEVFKQQVDNVAQCHIQLAQTL---REEARKMEEFREKQ-KLQRKKTETIMDAAHKQRNAQFK 135

  Fly    89 --FNAEQ-LEVVC-DKLTHLSQDKRKARKAYQEEHAKIAARLNHLTDEVVRKKSEYQKHLEGYKA 149
              .:|:: .|..| ||........|.|..|.|.:..|:..:|......|......|..|:...:.
Mouse   136 KAMDAKKNYEQKCRDKDEAEQAVHRSANVANQRQQEKLFVKLATSKTAVEDSDKAYMLHINMLEK 200

  Fly   150 LRTRFEENYIKAPSRSGRKLDDVRDKYQKACRKLHLTHNEYVLSITEAIEVEK--DFRNVLLPGL 212
            :|                  :|.:.::.|||            .:.||.|.|:  .|||.     
Mouse   201 VR------------------EDWQSEHIKAC------------EVFEAQECERINFFRNA----- 230

  Fly   213 LEHQQSVQESFILLWRNILQEAAQYGDLTADKYKEIQKRIDTVIGSINPTEEYGEFTEKYKT--S 275
                         ||.: |.:.:|......:.|::::|.::|.  ||....:|  |..:.||  :
Mouse   231 -------------LWLH-LNQLSQQCVANDEMYEQVRKSLETC--SIEKDIQY--FVNQRKTGQT 277

  Fly   276 PTTPLLFQ 283
            |..|::::
Mouse   278 PPAPIMYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341 48/224 (21%)
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
Pstpip2NP_038859.3 F-BAR_PSTPIP2 15..254 CDD:153356 49/231 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.