DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and gcy-19

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001348702.1 Gene:gcy-19 / 191650 WormBaseID:WBGene00001544 Length:1187 Species:Caenorhabditis elegans


Alignment Length:240 Identity:54/240 - (22%)
Similarity:100/240 - (41%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1113 LKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLE 1177
            |::.||.|:.|.:|:.:.....:.|.:|.:.|||...:.:.:..:.......:.||.|.|::||.
 Worm   626 LRKLDHENVNKFVGMSIDGPEYLAVWKLCMRGSLQDIIGQGNFSIDPFFMFCVIRDMAEGLKYLH 690

  Fly  1178 SKNC-IHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVK----WTAPEALNFGKY 1237
            :... :|.:|.:...||:.....|::|||:....||        :.|:|    |.|||.:   :.
 Worm   691 NSFLHVHANLRSGTVLVNESWQAKLTDFGLGTLAEE--------KKPMKRRQLWMAPEVI---RG 744

  Fly  1238 TSL-------CDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDT-----------GYRMPTPK- 1283
            |.|       .|::|..::..|:.::.:.       ....||.||           |...|.|: 
 Worm   745 TLLPHQIEKSADIYSLAVIASEVLTRKEA-------WNMAERKDTVDEIVYRIKKGGPNAPRPEL 802

  Fly  1284 -----STPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRLDN 1323
                 .....:..|:..||:.:...||..|.|.|::..::.:..|
 Worm   803 DMDGVEINHNLLILIRDCWSEEPADRPSADVICNLLKNMMPKKGN 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 51/226 (23%)
PTKc_Fes_like 1067..1315 CDD:270637 53/230 (23%)
gcy-19NP_001348702.1 PBP1_NPR_GC_like 45..467 CDD:107347
PKc_like 571..841 CDD:328722 53/232 (23%)
CYCc 876..1065 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.