DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and gcy-6

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001294696.1 Gene:gcy-6 / 191644 WormBaseID:WBGene00001533 Length:1086 Species:Caenorhabditis elegans


Alignment Length:305 Identity:70/305 - (22%)
Similarity:120/305 - (39%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 WELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPN 1120
            :::.||  |.:||:.         ||..|.::....|||...             |.::..||.|
 Worm   575 FQIQND--VEMERVA---------AKKHSIRMVFDNKTCATM-------------RQMRLIDHAN 615

  Fly  1121 IVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYL-ESKNCIHR 1184
            :.|.||:.:....:..|......|||...:||.|..:.......:.:|...|:.:: ||.:..|.
 Worm   616 LNKFIGMSLDAPQLYSVWRFCSRGSLADVIRKASMQMDGFFIYSLMKDIINGLTWIHESSHEFHG 680

  Fly  1185 DLAARNCLVDLEHSVKISDFGMS--REEEEYIVSDGMKQIPVKWTAPEALN----FGKYTSLCDV 1243
            .|.::|||::....:||:|||:.  |..::|..||.:      ||:||.|.    .|....  |:
 Worm   681 MLTSKNCLLNDRWQLKITDFGLRIFRTHDQYNKSDRL------WTSPELLRTDDILGSREG--DI 737

  Fly  1244 WSYGILMWEIFSKGDTPYSGMTNSRARERI----DTGYRMPTPKSTPEE-------MYRLMLQCW 1297
            :|:||:..|:.::............|.|.|    ..|.:.|.|....:|       :..|:..||
 Worm   738 YSFGIISAELITRSSVFDLENRKEDAEEIIYMLKKGGLQSPRPSLEHDESIEINPALLHLVRDCW 802

  Fly  1298 AADAESRPH-------------------FDEIYNVVDALILRLDN 1323
            ......||.                   .|.::||:::....|::
 Worm   803 TERPSERPDIKQVASQLRSMNTNRNDNLMDHVFNVLESYASTLED 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 65/284 (23%)
PTKc_Fes_like 1067..1315 CDD:270637 66/284 (23%)
gcy-6NP_001294696.1 PBP1_NPR_GC_like 29..445 CDD:107347
ANF_receptor 57..424 CDD:279440
PKc_like 585..822 CDD:304357 62/266 (23%)
HNOBA <847..879 CDD:285003 0/1 (0%)
CYCc 858..1048 CDD:214485
Guanylate_cyc 885..1070 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.