DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Y43C5B.2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_501907.1 Gene:Y43C5B.2 / 189849 WormBaseID:WBGene00012785 Length:245 Species:Caenorhabditis elegans


Alignment Length:225 Identity:69/225 - (30%)
Similarity:121/225 - (53%) Gaps:29/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   945 ASISLSTNRPLYEEE-WFHGVLPREEVVRLLNNDGDFLVR--ETIRNEESQIVLSVCWNGH---- 1002
            ||.:.|..||..|:| ::||.||||:|..:|.|:|||::|  |.........:|||.   |    
 Worm     2 ASGTASMQRPSIEKEPYYHGFLPREDVKTVLKNNGDFVIRISEPQAGSPRSNILSVM---HCVPP 63

  Fly  1003 -----KHFIVQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDD 1062
                 ||::::|.|:..| .|...|.||.|::  ::|.....:|:....|.:.:.|:.|||.:|:
 Worm    64 MEEEIKHYVIKTKGDKIF-IEKVSFLSIPEMV--EWHLTKKESVQKDVFLIKAISRQAWELDHDN 125

  Fly  1063 VVLLERIGRGNFGDVYKAKLKSTK----LDVAVKTCRMT-LPDEQKRKFLQEGRILKQYDHPNIV 1122
            :..|:::|.|.||:|....:|..|    :.||:|..::: |..||.::|:.|.|:::...||::|
 Worm   126 IEPLKKLGEGAFGEVMMGTMKFRKGGKSVQVAIKQAKLSNLTKEQIKEFMGEARVMRSLSHPHVV 190

  Fly  1123 KLIGICVQKQPIMIVMELVLGGSLLTYLRK 1152
            :..|:..::      :.:.|..||..:|.|
 Worm   191 RFYGVPRRR------VNVALCRSLNEFLAK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 33/97 (34%)
TyrKc 1063..1311 CDD:197581 26/95 (27%)
PTKc_Fes_like 1067..1315 CDD:270637 25/91 (27%)
Y43C5B.2NP_501907.1 SH2_Fps_family 11..104 CDD:198224 32/98 (33%)
PKc_like 130..>195 CDD:304357 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.