DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and sem-5

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_509342.1 Gene:sem-5 / 181055 WormBaseID:WBGene00004774 Length:228 Species:Caenorhabditis elegans


Alignment Length:163 Identity:37/163 - (22%)
Similarity:62/163 - (38%) Gaps:46/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 DHPFESSSGELDE------NSDRDIDNDEEEEDSASDDVLSMKDHCY---------CVPSLAASI 947
            :|.|:  :|..||      |:.:.::.||:             .|.|         .:||....:
 Worm     6 EHDFQ--AGSPDELSFKRGNTLKVLNKDED-------------PHWYKAELDGNEGFIPSNYIRM 55

  Fly   948 SLSTNRPLYEEEWFHGVLPREEVVRLLN----NDGDFLVRETIRNEESQIVLSVCW-NGHKHFIV 1007
            :        |..|:.|.:.|.:...||.    .||.||||: ..:...:..:||.: :..:||.|
 Worm    56 T--------ECNWYLGKITRNDAEVLLKKPTVRDGHFLVRQ-CESSPGEFSISVRFQDSVQHFKV 111

  Fly  1008 QTTGEGNFRFEGPPFASIQELIMHQYHSELPVT 1040
            .....|.:......|.|:.||:  .||....|:
 Worm   112 LRDQNGKYYLWAVKFNSLNELV--AYHRTASVS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 24/90 (27%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
sem-5NP_509342.1 SH3_GRB2_like_N 2..53 CDD:212738 12/61 (20%)
SH2_Grb2_like 56..151 CDD:199828 25/98 (26%)
SH3_GRB2_like_C 158..210 CDD:212739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.