DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and T08G5.2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_506484.3 Gene:T08G5.2 / 179900 WormBaseID:WBGene00011623 Length:178 Species:Caenorhabditis elegans


Alignment Length:195 Identity:38/195 - (19%)
Similarity:65/195 - (33%) Gaps:83/195 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 RSKLLNFQLKRSKPCKQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPS 890
            ||.|:..::::      ||        ::|.:|.:..|...                |.|.::| 
 Worm    24 RSNLVRSEIRK------CT--------QTVHEFQRTHERMD----------------GNKWLEP- 57

  Fly   891 VQISGHKDHPFESSSGELDENSDRD------IDNDEEEEDSASDDVLSMKDHC-----------Y 938
                        .::|||:...|..      :||....||   ||:|.::|.|           .
 Worm    58 ------------QTAGELNRKCDEAMNCLHVLDNCSVFED---DDILWLEDFCDSYRFFTGNFHE 107

  Fly   939 CVPSLAASISLSTNRP-----LYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVC 998
            |    |..|..:...|     |....:|  :|..:|....|::||..:         |.::.|.|
 Worm   108 C----AVKIDRNQKDPCVQDYLVNSPYF--MLNSDERCAKLHSDGACV---------SNVINSTC 157

  Fly   999  998
             Worm   158  157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 11/51 (22%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
T08G5.2NP_506484.3 DUF19 29..165 CDD:366713 35/190 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.