Sequence 1: | NP_524288.3 | Gene: | FER / 41118 | FlyBaseID: | FBgn0000723 | Length: | 1325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506484.3 | Gene: | T08G5.2 / 179900 | WormBaseID: | WBGene00011623 | Length: | 178 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 38/195 - (19%) |
---|---|---|---|
Similarity: | 65/195 - (33%) | Gaps: | 83/195 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 826 RSKLLNFQLKRSKPCKQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPS 890
Fly 891 VQISGHKDHPFESSSGELDENSDRD------IDNDEEEEDSASDDVLSMKDHC-----------Y 938
Fly 939 CVPSLAASISLSTNRP-----LYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVC 998
Fly 999 998 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FER | NP_524288.3 | F-BAR_Fes_Fer | 7..243 | CDD:153341 | |
SH2_Fps_family | 953..1039 | CDD:198224 | 11/51 (22%) | ||
TyrKc | 1063..1311 | CDD:197581 | |||
PTKc_Fes_like | 1067..1315 | CDD:270637 | |||
T08G5.2 | NP_506484.3 | DUF19 | 29..165 | CDD:366713 | 35/190 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |