DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and F11E6.8

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001255960.1 Gene:F11E6.8 / 178530 WormBaseID:WBGene00008711 Length:442 Species:Caenorhabditis elegans


Alignment Length:278 Identity:99/278 - (35%)
Similarity:165/278 - (59%) Gaps:22/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LSNDDVVLLERIGRGNFGDVYKAKLKSTK---LDVAVKTCRMTLPDEQKR------KFLQEGRIL 1113
            |.::.|||...:|:|.||:||:.:::...   :.||||    ||..|:.|      |||:||.::
 Worm   131 LPSEAVVLETIVGKGYFGNVYRGRMRDPAGRLIPVAVK----TLKGERARDIAHIEKFLREGVVM 191

  Fly  1114 KQYDHPNIVKLIGICVQK--QPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYL 1176
            |..|||:::.|:||.:..  .| .:|:..:.||.|.||:...:..|...:.:......|.||.||
 Worm   192 KHLDHPHVLSLLGISISPAGNP-WVVLPYMEGGDLKTYIADPNRALCVLELLDFAHQVAQGMSYL 255

  Fly  1177 ESKNCIHRDLAARNCLVDLEHSVKISDFGMS---REEEEYI--VSDGMKQIPVKWTAPEALNFGK 1236
            .:::.:|||||||||::..:..||::|||::   .::|.||  ...|..::|:||.|||:|...:
 Worm   256 AAQHFVHRDLAARNCMISADRIVKVADFGLAVDLLDKESYIDESETGPARLPLKWLAPESLRDRR 320

  Fly  1237 -YTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAAD 1300
             ::|..||||:|:||||:.::..:||..::|::.|..::||.|:|.|...|:.:|.||..||.:.
 Worm   321 VFSSATDVWSFGVLMWELLTRAASPYGEVSNTKVRHYLETGMRLPQPTHCPDIIYDLMQCCWRST 385

  Fly  1301 AESRPHFDEIYNVVDALI 1318
            .|.||.|..:.:.:.||:
 Worm   386 PEDRPDFVFLSHRLRALL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 96/264 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 93/264 (35%)
F11E6.8NP_001255960.1 PTKc 141..400 CDD:270623 93/263 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.