DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ark-1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001255654.1 Gene:ark-1 / 178218 WormBaseID:WBGene00000186 Length:1043 Species:Caenorhabditis elegans


Alignment Length:263 Identity:98/263 - (37%)
Similarity:145/263 - (55%) Gaps:14/263 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1061 DDVVLLERIGRGNFGDVYKAKLK----STKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNI 1121
            :.:.|.:.:|:|.||.|::|..|    |..:.||||.............||||..|:.:..|.::
 Worm   111 EKITLCKELGQGEFGSVWQAGWKNSAGSDVIQVAVKCVGSDKLLATSSSFLQEAAIMTRMRHEHV 175

  Fly  1122 VKLIGICVQKQPIMIVMELVLGGSLLTYLRKNS--NGLTTRQQMGMCRDAAAGMRYLESKNCIHR 1184
            |:|.|:.:..:.||:|.||...||||..|.|.:  :..............|.||.|||.:..|||
 Worm   176 VRLYGVVLDTKKIMLVSELATCGSLLECLHKPALRDSFPVHVLCDYAEQIAMGMSYLELQRLIHR 240

  Fly  1185 DLAARNCLVDLEHSVKISDFGMSRE---EEEYIVSD---GMKQIPVKWTAPEALNFGKYTSLCDV 1243
            ||||||.||.....|||||||:||.   .|:|..|:   .:| :|:.|.|||.:||.|:||..||
 Worm   241 DLAARNVLVFSPKLVKISDFGLSRSLGIGEDYYRSEFTPNLK-LPIAWCAPECINFLKFTSKSDV 304

  Fly  1244 WSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPT-PKSTPEEMYRLMLQCWAADAESRPHF 1307
            |:||:.:||:||.|:.|:.|.:.::..|.:|....:.| ||:.||::|.::.:.|....:.||.|
 Worm   305 WAYGVTIWEMFSYGEMPWKGRSGAQILELVDRKKELLTRPKACPEDIYDMLKETWTHQVQDRPTF 369

  Fly  1308 DEI 1310
            .:|
 Worm   370 SDI 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 98/261 (38%)
PTKc_Fes_like 1067..1315 CDD:270637 97/257 (38%)
ark-1NP_001255654.1 SAM_superfamily 14..71 CDD:301707
TyrKc 113..376 CDD:197581 98/261 (38%)
PTKc_Ack_like 117..378 CDD:270636 97/257 (38%)
SH3 384..434 CDD:214620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.