DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and kin-26

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_501309.1 Gene:kin-26 / 177575 WormBaseID:WBGene00002208 Length:433 Species:Caenorhabditis elegans


Alignment Length:392 Identity:134/392 - (34%)
Similarity:215/392 - (54%) Gaps:32/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   942 SLAASISLSTNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVR--ETIRNEESQIVLSVCWNGH-- 1002
            ||.:.:|   |..:.:|.::||:||.|:|.:||:|:||||:|  |.........:|||.:|..  
 Worm     5 SLPSEVS---NATIDKELYYHGLLPSEDVRQLLSNNGDFLLRSSEPEPGSPRTHILSVMFNNRLD 66

  Fly  1003 -----KHFIVQTTGEGNFRFEGPPFASIQELI-MHQYHSELPVTVKSGAILRRPVCRERWELSND 1061
                 |||:|.......|..:...|.|||::: .:|.::   ..:|.|.:|..|:.|:.|||.:|
 Worm    67 DINSIKHFVVNFVDGKYFINDKMSFPSIQKMLGTYQRNN---TEIKEGCMLVNPIRRQFWELEHD 128

  Fly  1062 DVVLLERIGRGNFGDVYKAKLKSTK----LDVAVKTCRMTLPDEQKRK-FLQEGRILKQYDHPNI 1121
            .:.:.:::|.|.||:|....:|..|    :.||:|..::....:.|.| ||.|.|.:::..|.||
 Worm   129 QITIHKKLGEGAFGEVSSGVMKFKKGMKTVQVAIKQVKLDKTGKAKIKDFLAEARTMRKLGHQNI 193

  Fly  1122 VKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDL 1186
            :|..|:.|.::|:.:||||.:.|:|.::|:||.: |:..::..|...||.|:.|:..|..:|||:
 Worm   194 IKFYGVGVLQEPLYLVMELAVNGALDSFLKKNED-LSVDKKTEMILQAAWGLEYIHGKPMLHRDI 257

  Fly  1187 AARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLC----DVWSYG 1247
            ||||||. .:..|||||||::|....|.:....|. |::|.|.|.:.    |.:|    |||:||
 Worm   258 AARNCLY-TDGKVKISDFGLTRNGTVYQIKPNTKS-PIRWLAIETIK----TMICSEKTDVWAYG 316

  Fly  1248 ILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYN 1312
            :|.||||:....||.||..:....::..|||||.......|:..:|.:|.|.:...||...||..
 Worm   317 VLCWEIFNNAAEPYPGMKPADVATQVANGYRMPPYPHAQAEIQTMMARCNAENPNDRPSMAEIAE 381

  Fly  1313 VV 1314
            ::
 Worm   382 IL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 30/95 (32%)
TyrKc 1063..1311 CDD:197581 90/256 (35%)
PTKc_Fes_like 1067..1315 CDD:270637 91/257 (35%)
kin-26NP_501309.1 SH2_Fps_family 15..108 CDD:198224 30/95 (32%)
TyrKc 130..383 CDD:197581 91/259 (35%)
PTKc 134..384 CDD:270623 91/257 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 1 1.100 - - O PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.