DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ver-1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_497162.2 Gene:ver-1 / 175182 WormBaseID:WBGene00006894 Length:1083 Species:Caenorhabditis elegans


Alignment Length:278 Identity:82/278 - (29%)
Similarity:134/278 - (48%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 WELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQY-DHP 1119
            :|...|.:.:||.||.|:||.|.:..||.||..||||:.........::..::|.:::... .||
 Worm   796 FEFHKDSLEILEPIGSGHFGVVRRGILKGTKTVVAVKSSSYRSSIGFQKVIVEELKLMSAIPKHP 860

  Fly  1120 NIVKLIGIC---VQKQPIMIVMELVLGGSLLTYL----------------------RKNSNGLTT 1159
            |::.|:|..   ::...:.|:||.:.||:|..:|                      |.:.|.|:|
 Worm   861 NVLALVGAITKNLRHGELYILMEYIDGGNLRDFLQQRRNVFIDELHDNFDENIPLIRPDFNSLST 925

  Fly  1160 RQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPV 1224
            ...:|:....|.||.:|.:..|:|.:|..|..|:....:::|:|:|:...:.        |...:
 Worm   926 TDLVGIAHQIANGMEWLGNVPCVHGNLCCRKVLISKTKTIRITDYGVGDRQR--------KSSSM 982

  Fly  1225 KWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEM 1289
            :|.||||:....::|..||||:||.::|||:.|.|||.........:.|..|.|...|:..|..:
 Worm   983 RWMAPEAIEHQMFSSKSDVWSFGICLYEIFTLGGTPYPTCVTENILKHIKNGSRNLQPEYCPSAL 1047

  Fly  1290 YRLMLQCWAADAESRPHF 1307
            |.||..||.|..:.||.|
 Worm  1048 YDLMQLCWRAPPQDRPKF 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 80/271 (30%)
PTKc_Fes_like 1067..1315 CDD:270637 79/267 (30%)
ver-1NP_497162.2 Ig <294..331 CDD:299845
ig 576..652 CDD:278476
IG_like 578..654 CDD:214653
IG_like 660..731 CDD:214653
IGc2 674..722 CDD:197706
Pkinase_Tyr 803..1072 CDD:285015 80/271 (30%)
PTKc 807..1073 CDD:270623 79/267 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.