DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and R09D1.12

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_496025.2 Gene:R09D1.12 / 174501 WormBaseID:WBGene00011168 Length:455 Species:Caenorhabditis elegans


Alignment Length:320 Identity:91/320 - (28%)
Similarity:148/320 - (46%) Gaps:85/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 RIGRGNFGDVYKAKL--------KSTKLDVAVKTCRMTLP-DEQKRKFLQEGRILKQYD------ 1117
            ::|:|.||.:.|..|        :..:::||||  :|..| ||::.|.:        ||      
 Worm   131 KLGKGKFGIINKGLLTLRICKTNEVVQVNVAVK--KMVDPTDEKQDKLI--------YDEIKLMC 185

  Fly  1118 ----HPNIVKLIGICVQKQPI------MIVMELVLGGSLLTYLRKN----SNGLTTRQQMG---- 1164
                |||::.::|...:|:.:      ..|.|.:.||.|.:.||.:    .:.:|:|::.|    
 Worm   186 AIGKHPNVLAIVGAITKKEKVSGREYNQAVSEFIEGGDLRSVLRNSPYTFQDEITSRERTGGQNV 250

  Fly  1165 ---------------MCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR---EEE 1211
                           .....|.||.||.|..|:|||||.||..|.....::|.|||::|   :::
 Worm   251 DAEVFDTISTSDLFSFAYQIANGMEYLASLPCVHRDLALRNVFVKKNKIIRIGDFGLARHNGDKD 315

  Fly  1212 EYIVSDGMK-QIPVKWTAPEALNFG-KYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARER-- 1272
            .|.|....: .:|:.|.|||..:.| .:|.:.||||||:.::|:||.|.:||        .|.  
 Worm   316 YYKVKYSPETPLPIFWLAPECFDDGTSFTEMTDVWSYGVCLFELFSLGASPY--------LEEFQ 372

  Fly  1273 ------------IDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILR 1320
                        :::|.|:.:||....::|..||:||.:||:.||.|.:.......||.|
 Worm   373 NFFDPIYYVVAFLESGKRLSSPKYCRSDIYNFMLECWNSDAKQRPRFTKCKEFFKNLIKR 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 88/309 (28%)
PTKc_Fes_like 1067..1315 CDD:270637 88/313 (28%)
R09D1.12NP_496025.2 TyrKc 127..426 CDD:197581 88/312 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.