DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and C35E7.10

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_492826.1 Gene:C35E7.10 / 172988 WormBaseID:WBGene00016462 Length:430 Species:Caenorhabditis elegans


Alignment Length:373 Identity:132/373 - (35%)
Similarity:216/373 - (57%) Gaps:27/373 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   951 TNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVR--ETIRNEESQIVLSVCWNGHK-----HFIVQ 1008
            |::.|..::::||:||||::..:||..|.||:|  |.::.|:.|.||||.  |.|     ||:|:
 Worm     2 TDKDLLHQKYYHGLLPREDIQEMLNKPGQFLLRTSEPVKGEKRQFVLSVV--GEKKTSANHFVVR 64

  Fly  1009 TTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSG---AILRRPVCRERWELSNDDVVLLERIG 1070
            .: :.....:...|.:|.||:.|...::...:.|.|   |:|::.|.|::|||.::||.|.:::|
 Worm    65 ES-DHKVYVDKIGFPTIIELVNHYVSTKESFSTKDGTVKAVLKQAVERQKWELYHEDVELTKKLG 128

  Fly  1071 RGNFGDVYKAKLKSTKLD-------VAVKTCRM-TLPDEQKRKFLQEGRILKQYDHPNIVKLIGI 1127
            .|.||:|:|.||... ||       |||||.:: ::..||.::.::|.|:::..||.|:||..|:
 Worm   129 EGAFGEVWKGKLLKI-LDANHQPVLVAVKTAKLESMTKEQIKEIMREARLMRNLDHINVVKFFGV 192

  Fly  1128 CVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCL 1192
            ....:|:.::|||..||:|.:.|.|....:..:.:  :...||.|:.|:..||.:|||:||||||
 Worm   193 AAGTEPLYVIMELADGGALDSALGKLHFPMIKKYE--LIYQAANGLAYIHEKNLMHRDVAARNCL 255

  Fly  1193 VDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKG 1257
            .. ...|||:|||:|||..:|.: |..|::|::|..||.:..|.||...||:::|::.|||...|
 Worm   256 YG-GGQVKIADFGLSREGADYTM-DLKKKVPIRWLPPETIRSGLYTPKTDVFAFGVMAWEITEDG 318

  Fly  1258 DTPYSGMTNSRARERIDTGYRMP-TPKSTPEEMYRLMLQCWAADAESR 1304
            ..||.|........::..||||| :|:...|....::.:||....|.|
 Worm   319 KEPYPGFKVIEVAMKVLQGYRMPFSPEVNKEFAEFILTKCWPEKYEDR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 30/92 (33%)
TyrKc 1063..1311 CDD:197581 91/251 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 89/247 (36%)
C35E7.10NP_492826.1 SH2_Fps_family 4..93 CDD:198224 30/91 (33%)
TyrKc 121..376 CDD:197581 91/251 (36%)
PTKc 125..374 CDD:270623 89/247 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 1 1.100 - - O PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.