DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Lyn

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001104566.1 Gene:Lyn / 17096 MGIID:96892 Length:512 Species:Mus musculus


Alignment Length:411 Identity:144/411 - (35%)
Similarity:215/411 - (52%) Gaps:59/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   948 SLSTNR-------------PLYEEEWFHGVLPREEVVRLL----NNDGDFLVR--ETIRNEESQI 993
            |||:.|             .|..||||...:.|::..|.|    |:.|.||:|  ||::...|  
Mouse   104 SLSSKREGFIPSNYVAKVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFS-- 166

  Fly   994 VLSV----CWNGH--KHFIVQTTGEGNFRFEGP--PFASIQELIMHQYHSELPVTVKSGAILRR- 1049
             |||    ..:|.  ||:.:::...|.: :..|  .|..|.::|.| |..:      |..:.|| 
Mouse   167 -LSVRDYDPMHGDVIKHYKIRSLDNGGY-YISPRITFPCISDMIKH-YQKQ------SDGLCRRL 222

  Fly  1050 -----------PVCRERWELSNDDVVLLERIGRGNFGDVYKAKL-KSTKLDVAVKTCRMTLPDEQ 1102
                       |..::.||:..:.:.|::::|.|.||:|:.... .|||  |||||.:......|
Mouse   223 EKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGYYNNSTK--VAVKTLKPGTMSVQ 285

  Fly  1103 KRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNG-LTTRQQMGMC 1166
              .||:|..::|...|..:|:|..:..:::||.|:.|.:..||||.:|:.:..| :...:.:...
Mouse   286 --AFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFS 348

  Fly  1167 RDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR--EEEEYIVSDGMKQIPVKWTAP 1229
            ...|.||.|:|.||.|||||.|.|.||......||:|||::|  |:.||...:|.| .|:|||||
Mouse   349 AQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAK-FPIKWTAP 412

  Fly  1230 EALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLML 1294
            ||:|||.:|...||||:|||::||.:.|..||.|.||:.....:..|||||..::.|:|:|.:|.
Mouse   413 EAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMK 477

  Fly  1295 QCWAADAESRPHFDEIYNVVD 1315
            .||...||.||.||.:.:|:|
Mouse   478 MCWKEKAEERPTFDYLQSVLD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 30/112 (27%)
TyrKc 1063..1311 CDD:197581 103/251 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 103/251 (41%)
LynNP_001104566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SH3_Lyn 67..122 CDD:212937 4/17 (24%)
SH2_Src_Lyn 125..225 CDD:198227 31/110 (28%)
PTKc_Lyn 239..510 CDD:270657 107/265 (40%)
Pkinase_Tyr 247..497 CDD:285015 103/254 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.