DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Tesk2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_596887.1 Gene:Tesk2 / 170908 RGDID:619984 Length:570 Species:Rattus norvegicus


Alignment Length:273 Identity:76/273 - (27%)
Similarity:135/273 - (49%) Gaps:18/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIV 1122
            |::.|....|:||.|.|.:|:|.:.:::...:|:|   |......:...|:|.:::.:..||||:
  Rat    53 LTSLDDFTREKIGSGFFSEVFKVRHRASGQVMALK---MNTLSSNRANLLKEMQLMNRLSHPNIL 114

  Fly  1123 KLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLA 1187
            :.:|:||.:..:..:.|.:..|:|...|..|.. |....::.:..|.|.|:.||..|...||||.
  Rat   115 RFMGVCVHQGQLHALTEYINSGNLEQLLDSNLY-LPWTVRVKLAYDIAVGLSYLHFKGIFHRDLT 178

  Fly  1188 ARNCLVDLE---HSVKISDFGMSREEEEYIVSDGMKQIPVK----WTAPEALNFGKYTSLCDVWS 1245
            ::|||:..:   :|..::|||::.:..:  .|.|.:::.|.    |.|||.|....|....||:|
  Rat   179 SKNCLIKRDENGYSAVVADFGLAEKIPD--ASIGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFS 241

  Fly  1246 YGILMWEIFSK--GDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFD 1308
            |||::.||.::  .|..|...|.:..   :|...........|.:..:|...|...|.:.||.|:
  Rat   242 YGIILCEIIARIQADPDYLPRTENFG---LDYDAFQHMVGDCPSDFLQLTFNCCNMDPKLRPSFE 303

  Fly  1309 EIYNVVDALILRL 1321
            ||...::.::.||
  Rat   304 EIGKTLEEIMSRL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 71/256 (28%)
PTKc_Fes_like 1067..1315 CDD:270637 72/256 (28%)
Tesk2NP_596887.1 PKc_TESK 64..316 CDD:271057 71/260 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.