DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Grb2

DIOPT Version :10

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_032189.1 Gene:Grb2 / 14784 MGIID:95805 Length:217 Species:Mus musculus


Alignment Length:93 Identity:31/93 - (33%)
Similarity:44/93 - (47%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   960 WFHGVLPR---EEVVRLLNNDGDFLVRETIRNEESQIVLSVCW-NGHKHFIVQTTGEGNFRFEGP 1020
            ||.|.:||   ||::....:||.||:||: .:......|||.: |..:||.|...|.|.:.....
Mouse    60 WFFGKIPRAKAEEMLSKQRHDGAFLIRES-ESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV 123

  Fly  1021 PFASIQELIMHQYHSELPVTVKSGAILR 1048
            .|.|:.||:  .||....|:......||
Mouse   124 KFNSLNELV--DYHRSTSVSRNQQIFLR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 28/82 (34%)
PTKc_Fes_like 1067..1315 CDD:270637
Grb2NP_032189.1 SH3_GRB2_N 1..56 CDD:212879
SH2_Grb2_like 56..150 CDD:199828 31/93 (33%)
SH3_GRB2_C 160..212 CDD:212882
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.