DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Fgfr3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001156689.1 Gene:Fgfr3 / 14184 MGIID:95524 Length:802 Species:Mus musculus


Alignment Length:333 Identity:112/333 - (33%)
Similarity:164/333 - (49%) Gaps:59/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 EGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKA-- 1080
            |||..|::.||       |||...|             ||||...:.|.:.:|.|.||.|..|  
Mouse   443 EGPVLANVSEL-------ELPADPK-------------WELSRTRLTLGKPLGEGCFGQVVMAEA 487

  Fly  1081 ----KLKSTK-LDVAVKTCRMTLPDEQKRKFLQEGRILKQY-DHPNIVKLIGICVQKQPIMIVME 1139
                |.::.| :.||||..:....|:.....:.|..::|.. .|.||:.|:|.|.|..|:.:::|
Mouse   488 IGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVE 552

  Fly  1140 LVLGGSLLTYLRKNSNGLTTRQQMGM---------------CRD-------AAAGMRYLESKNCI 1182
            ....|:|..:||       .|:..||               |:|       .|.||.||.|:.||
Mouse   553 YAAKGNLREFLR-------ARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCI 610

  Fly  1183 HRDLAARNCLVDLEHSVKISDFGMSREEE--EYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWS 1245
            ||||||||.||..::.:||:|||::|:..  :|.......::||||.|||||....||...||||
Mouse   611 HRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWS 675

  Fly  1246 YGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEI 1310
            :|:|:||||:.|.:||.|:......:.:..|:||..|.|...::|.:|.:||.|....||.|.::
Mouse   676 FGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQL 740

  Fly  1311 YNVVDALI 1318
            ...:|.::
Mouse   741 VEDLDRIL 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 8/20 (40%)
TyrKc 1063..1311 CDD:197581 97/279 (35%)
PTKc_Fes_like 1067..1315 CDD:270637 96/279 (34%)
Fgfr3NP_001156689.1 IGc2 51..110 CDD:197706
IG 52..108 CDD:214652
Ig2_FGFR 155..239 CDD:143265
IG_like 254..349 CDD:214653
Ig3_FGFR 262..350 CDD:143175
PTKc_FGFR3 455..788 CDD:173652 105/314 (33%)
Pkinase_Tyr 468..744 CDD:285015 97/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.