DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Ptk2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_006520478.1 Gene:Ptk2 / 14083 MGIID:95481 Length:1140 Species:Mus musculus


Alignment Length:261 Identity:106/261 - (40%)
Similarity:154/261 - (59%) Gaps:9/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 WELSNDDVVLLERIGRGNFGDVYKAKLKSTK---LDVAVKTCRMTLPDEQKRKFLQEGRILKQYD 1117
            :|:..:.:.|...||.|.||||::....|.:   |.||:|||:....|..:.|||||...::|:|
Mouse   500 YEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFD 564

  Fly  1118 HPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCI 1182
            ||:||||||: :.:.|:.|:|||...|.|.::|:.....|.....:......:..:.|||||..:
Mouse   565 HPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFV 628

  Fly  1183 HRDLAARNCLVDLEHSVKISDFGMSREEEE---YIVSDGMKQIPVKWTAPEALNFGKYTSLCDVW 1244
            |||:||||.||.....||:.|||:||..|:   |..|.|  ::|:||.|||::||.::||..|||
Mouse   629 HRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKG--KLPIKWMAPESINFRRFTSASDVW 691

  Fly  1245 SYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDE 1309
            .:|:.||||...|..|:.|:.|:....||:.|.|:|.|.:.|..:|.||.:|||.|...||.|.|
Mouse   692 MFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTE 756

  Fly  1310 I 1310
            :
Mouse   757 L 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 105/254 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 104/250 (42%)
Ptk2XP_006520478.1 FERM_N_2 79..174 CDD:407875
B41 80..302 CDD:214604
FERM_C_FAK1 298..408 CDD:270011
PTKc_FAK 500..769 CDD:133187 106/261 (41%)
Focal_AT 1004..1133 CDD:397606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.