DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AgaP_AGAP011768

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_320742.3 Gene:AgaP_AGAP011768 / 1280872 VectorBaseID:AGAP011768 Length:211 Species:Anopheles gambiae


Alignment Length:200 Identity:50/200 - (25%)
Similarity:81/200 - (40%) Gaps:49/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   899 HPFESSSGELDENSDR--------DIDND--------EEEEDSASDDVLSMKDHCYCVPSLAASI 947
            |.|.:::.  ||.|.|        ::::|        :.:|.....:.:.||:|           
Mosquito     7 HDFNATAD--DELSFRKSQVLKILNMEDDMNWYRAELDGKEGLIPSNYIEMKNH----------- 58

  Fly   948 SLSTNRPLYEEEWFHGVLPREEVVRLLNN--DGDFLVRETIRNEESQIVLSV-CWNGHKHFIVQT 1009
                       :|::|.:.|.:..:||:|  :|.||:|.: .:......||| |.:|.:||.|..
Mosquito    59 -----------DWYYGRITRADAEKLLSNKHEGAFLIRIS-ESSPGDFSLSVKCSDGVQHFKVLR 111

  Fly  1010 TGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNF 1074
            ..:|.|......|.|:.||:  .||....|:......||..|..|....:..|.|..|. |..:|
Mosquito   112 DAQGKFFLWVVKFNSLNELV--DYHRTASVSRSQDVKLRDMVPEEMLVQALYDFVAQES-GELDF 173

  Fly  1075 --GDV 1077
              |||
Mosquito   174 RRGDV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 26/88 (30%)
TyrKc 1063..1311 CDD:197581 6/16 (38%)
PTKc_Fes_like 1067..1315 CDD:270637 5/12 (42%)
AgaP_AGAP011768XP_320742.3 SH3_GRB2_like_N 2..53 CDD:212738 8/47 (17%)
SH2_Grb2_like 56..149 CDD:199828 30/117 (26%)
SH3_GRB2_like_C 156..208 CDD:212739 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.