DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AgaP_AGAP008009

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_317454.4 Gene:AgaP_AGAP008009 / 1277939 VectorBaseID:AGAP008009 Length:519 Species:Anopheles gambiae


Alignment Length:265 Identity:75/265 - (28%)
Similarity:132/265 - (49%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 CRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQY 1116
            ||.|         |...:..|.||.||:.....:: :|.|||........|....|.||..|...
Mosquito   251 CRVR---------LSSLLQEGTFGRVYRGSYNDSQ-EVLVKTVGPHASQVQVSLLLHEGMSLYGA 305

  Fly  1117 DHPNIVKLIGICVQKQ--PIMIVMELVLGGSLLTYLRKN-SNGLTTRQQMGMCRDAAAGMRYLES 1178
            .||.|:.::|:.:...  |.::.:......:|..:|::. :..|||.|.:.:....|..:.:|.|
Mosquito   306 QHPGILSVLGVSIDDHTAPFLLYLAPENTRNLKIFLQEPVARTLTTIQIVKIQLQLAQALGHLHS 370

  Fly  1179 KNCIHRDLAARNCLVDLEHSVKISDFGMSRE---EEEYIVSDGMKQIPVKWTAPEALNFGKYTSL 1240
            ...||:|:|||||::|.:..||::|..:||:   .:.|.:.|...: |:||.|.|::.|.:::..
Mosquito   371 HGVIHKDIAARNCVIDDQLRVKLADNSLSRDLFPGDYYCLGDSENR-PIKWLALESIQFKQFSES 434

  Fly  1241 CDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRP 1305
            .|.|::|:||||:.:....||:.:........:..|||:..|.:.|:|::.:|..||......||
Mosquito   435 SDTWAFGVLMWELCTLARQPYAEVDPFEMEHYLRDGYRLSQPINCPDELFAIMAYCWTMMPMERP 499

  Fly  1306 HFDEI 1310
            .|:::
Mosquito   500 SFEQL 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 72/254 (28%)
PTKc_Fes_like 1067..1315 CDD:270637 71/250 (28%)
AgaP_AGAP008009XP_317454.4 WIF 1..115 CDD:280237
PKc_like 246..515 CDD:304357 75/265 (28%)
Pkinase_Tyr 253..508 CDD:285015 73/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.