DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Bmx

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_033889.2 Gene:Bmx / 12169 MGIID:1101778 Length:655 Species:Mus musculus


Alignment Length:438 Identity:150/438 - (34%)
Similarity:226/438 - (51%) Gaps:60/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   920 EEEEDSASDDVLSMKDHCYCVPSLA----ASISLSTNRPLYEEEWFHGVLPR---EEVVRLLNND 977
            :.|||.|..:.|......:....::    .|.|......|:..:||.|.:.|   |:::|....:
Mouse   232 KSEEDIACSNQLERNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRSQSEQLLRQKGKE 296

  Fly   978 GDFLVRETIR-------------NEESQIVLSVCWNGHKHFIVQTTGEGN-FRFEGPPFASIQEL 1028
            |.|:||.:.:             |::...|        ||:.|.|..|.. :..|...|.||.:|
Mouse   297 GAFMVRNSSQMGMYTVSLFSKAVNDKKGTV--------KHYHVHTNAENKLYLAENYCFDSIPKL 353

  Fly  1029 I-MHQYHS----------------ELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGD 1076
            | .||::|                ::||:|..|:.:        |||..:::.||:.:|.|.||.
Mouse   354 IHYHQHNSAGMITRLRHPVSTKANKVPVSVALGSGI--------WELKREEITLLKELGNGQFGV 410

  Fly  1077 VYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELV 1141
            |...:.|. :.|||||..:.....|.  :|.||.:.:.:..||.:||..|:|.:|.||.||.|.:
Mouse   411 VQLGQWKG-QYDVAVKMIKEGAMSED--EFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYI 472

  Fly  1142 LGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGM 1206
            ..|.||.||:.:..||.:.|.:.||.|...||.:|||...|||||||||||||.:.|||:|||||
Mouse   473 TNGCLLNYLKSHGKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGM 537

  Fly  1207 SRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRA 1269
            :|.  :::|:.|.|.| .||||:|||..::.||:|..|||::||||||:||.|..||....||..
Mouse   538 TRYVLDDQYVSSVGTK-FPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSEV 601

  Fly  1270 RERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            ..::..|:|:..|:...:.:|::|..||....|.||.|.::.:.::.|
Mouse   602 VVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLSAIEPL 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 27/119 (23%)
TyrKc 1063..1311 CDD:197581 108/249 (43%)
PTKc_Fes_like 1067..1315 CDD:270637 106/249 (43%)
BmxNP_033889.2 PH_Btk 25..151 CDD:269944
PH 27..115 CDD:278594
SH2_Tec_Bmx 269..374 CDD:198262 27/112 (24%)
PKc_like 392..647 CDD:304357 109/258 (42%)
Pkinase_Tyr 397..646 CDD:285015 108/252 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.