DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and TNK2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_011510619.1 Gene:TNK2 / 10188 HGNCID:19297 Length:1219 Species:Homo sapiens


Alignment Length:266 Identity:96/266 - (36%)
Similarity:146/266 - (54%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LSNDDVVLLERIGRGNFGDVYKAKLKSTK---LDVAVKTCRMTLPD-----EQKRKFLQEGRILK 1114
            :...|:.|||::|.|:||.|.:.:..:..   :.||||..:   ||     |....|::|...:.
Human   285 IGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLK---PDVLSQPEAMDDFIREVNAMH 346

  Fly  1115 QYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSN----GLTTRQQMGMCRDAAAGMRY 1175
            ..||.|:::|.|: |...|:.:|.||...||||..|||:..    |..:|..:    ..|.||.|
Human   347 SLDHRNLIRLYGV-VLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAV----QVAEGMGY 406

  Fly  1176 LESKNCIHRDLAARNCLVDLEHSVKISDFGMSR---EEEEYIVSDGMKQIPVKWTAPEALNFGKY 1237
            ||||..|||||||||.|:.....|||.|||:.|   :.:::.|....:::|..|.|||:|....:
Human   407 LESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTF 471

  Fly  1238 TSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERID-TGYRMPTPKSTPEEMYRLMLQCWAADA 1301
            :...|.|.:|:.:||:|:.|..|:.|:..|:...:|| .|.|:|.|:..|:::|.:|:||||...
Human   472 SHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKP 536

  Fly  1302 ESRPHF 1307
            |.||.|
Human   537 EDRPTF 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 95/261 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 93/257 (36%)
TNK2XP_011510619.1 SAM_TNK-like 170..231 CDD:188938
STYKc 290..549 CDD:214568 95/261 (36%)
PTKc_Ack_like 294..551 CDD:270636 93/257 (36%)
SH3_9 559..608 CDD:291278
GTPase_binding 611..678 CDD:286160
Inhibitor_Mig-6 953..1017 CDD:288414
UBA_ACK1 1140..1183 CDD:270460
UBA_TNK1 1170..1209 CDD:270513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.