DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and slc39a8

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_002934812.2 Gene:slc39a8 / 100487145 XenbaseID:XB-GENE-1011741 Length:459 Species:Xenopus tropicalis


Alignment Length:194 Identity:43/194 - (22%)
Similarity:67/194 - (34%) Gaps:57/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 IEHV--------NGGSPVANGSIISNGSNTS--NGIQSNKDSLCRQSKDLNALRCQEKQKQKLVD 387
            |:||        :..:.:.||:||.:....:  ||: ::.|::...|||             .|:
 Frog   233 IDHVPHQEFHIESPANKIPNGNIIYSNPAVAEVNGV-NHLDNIKVSSKD-------------AVE 283

  Fly   388 MIKCA-------LNEVGCEELPSGCDDDLTLEQNFIEN-----GYNNEQQRSNSTSSPGLGIM-N 439
            .:.|.       |..:|.........|.|   .|||:.     .:.....:..|||   :.|: .
 Frog   284 EVYCCKVLKWRPLKSIGTLAWMITLSDAL---HNFIDGLAIGASFTLSVLQGLSTS---IAILCE 342

  Fly   440 ELMRRGGVLTLLRGRGRHFKRKSTPQPATPMTRSRQGRFNKLQPRSQSLGSLSVIRDGNGPSPA 503
            |.....|...:|...|     .|.||..|         ||.|...|..:|.:..|..||...|:
 Frog   343 EFPHEFGDFAILINAG-----MSIPQALT---------FNFLSACSCYIGLVFGILVGNNFEPS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
slc39a8XP_002934812.2 Zip 128..450 CDD:396884 43/194 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.