DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and srms

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001129722.2 Gene:srms / 100192213 ZFINID:ZDB-GENE-081022-95 Length:492 Species:Danio rerio


Alignment Length:511 Identity:152/511 - (29%)
Similarity:255/511 - (49%) Gaps:62/511 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 CKQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNC-PPAGQKPVKPSVQISGHKDHPFES 903
            |..|.||        ::|            |...|.:.|. .|...:.|...:::...|..|.:.
Zfish     8 CMPCLKR--------LWD------------SIWPENYPNLHRPDDIRTVSGDIRVPAPKKKPAQL 52

  Fly   904 SSGELDENSDRDIDNDEEEEDSASDDVLSM----KDHCYC---VPSLAASISLSTNRPLYEEE-- 959
            .:...|     .:...|||......|.||:    .|:.:.   ..||.:.:..:....|.::|  
Zfish    53 YAALFD-----FVARSEEELSVKEGDKLSVIEKRGDYVFAKKLTGSLESGLIPANYVALLKDEFA 112

  Fly   960 ---WFHGVLPREEVVRLL----NNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEG-NFR 1016
               |::|.:.|::..:||    |..|.||||.:..:.:...:.:...|...||.:..:..| .|.
Zfish   113 NYKWYYGNINRQKAEKLLLSSENKTGSFLVRISESHSDEYTISARSENSVFHFRIHRSPIGAYFV 177

  Fly  1017 FEGPPFASIQELIMH--QYHSELPVTVKSGAILRRPVC-RERWELSNDDVVLLERIGRGNFGDVY 1078
            .|...|.::.|||.:  |....|...:....:.||.:. .|.||...::.:|::::|.|:||:|:
Zfish   178 SEKISFGTLDELIRYYQQNSRSLGCHIDQPCVQRRELFDMEPWERPREEFMLVKKLGEGHFGEVW 242

  Fly  1079 KAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLG 1143
            :|..|:.|..||:|..:.  .|.:..:|::|...||...||.:::|:.:|.:.:|:.||.||:..
Zfish   243 EAIWKTQKKKVAIKMLKQ--EDTKLDEFVKEVHALKNLHHPKLIELLALCSRGEPVYIVTELMAK 305

  Fly  1144 GSLLTYLRKNSNG--LTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGM 1206
            |||.:|| .::.|  ||:...:.|....|.||.|||.::.:||||||||.||..:...|::|||:
Zfish   306 GSLKSYL-SSAEGQLLTSAHLIYMAAQIAEGMAYLEDRHIVHRDLAARNILVGNDLVCKVADFGL 369

  Fly  1207 SREEEEYIVSDGM------KQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMT 1265
            :|     |:.|.:      .:|||:||||||..:.:::...||||:|:|::|:.|:|..||.|.|
Zfish   370 AR-----IIKDSVFTASKTTKIPVRWTAPEAALYQRFSVKSDVWSFGVLLYEMMSRGKMPYDGKT 429

  Fly  1266 NSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRL 1321
            |....|.:.:|||:..|...|..:||:||:||..:|..||.|..:::.:|.:..||
Zfish   430 NKEVMEALSSGYRLACPNHCPPNIYRIMLECWNNEASKRPSFHALHSQLDNIYSRL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 25/97 (26%)
TyrKc 1063..1311 CDD:197581 97/255 (38%)
PTKc_Fes_like 1067..1315 CDD:270637 96/255 (38%)
srmsNP_001129722.2 SH3 52..106 CDD:302595 10/58 (17%)
SH2 114..197 CDD:214585 22/82 (27%)
PKc_like 220..481 CDD:304357 100/268 (37%)
STYKc 229..478 CDD:214568 97/256 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.