DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and tnk2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_031757304.1 Gene:tnk2 / 100124754 XenbaseID:XB-GENE-984470 Length:1151 Species:Xenopus tropicalis


Alignment Length:266 Identity:98/266 - (36%)
Similarity:149/266 - (56%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LSNDDVVLLERIGRGNFGDVYKAKLKSTK---LDVAVKTCR---MTLPDEQKRKFLQEGRILKQY 1116
            :|..|:.:.|::|.|:||.|.:.:..:..   .:||||..:   :|.||... .|::|...:...
 Frog   144 ISEKDLSMFEKLGDGSFGVVRRGEWNTPNGKLFNVAVKCLKTDVLTQPDVLD-DFIREVNAMHSL 207

  Fly  1117 DHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNG--LTTRQQMGMCRDA---AAGMRYL 1176
            ||.|:::|.|: |...|:.:|.||...||||..||||...  ::|     :|..|   |.||.||
 Frog   208 DHINLIRLYGV-VLTHPMKMVTELAPMGSLLDRLRKNQGYFLIST-----LCHYAIQIANGMAYL 266

  Fly  1177 ESKNCIHRDLAARNCLVDLEHSVKISDFGMSR----EEEEYIVSDGMKQIPVKWTAPEALNFGKY 1237
            |||..|||||||||.|:.....|||.|||:.|    .::.|::.:..| :|..|.|||:|....:
 Frog   267 ESKRFIHRDLAARNILLSSNDLVKIGDFGLMRALPKNDDHYVMQEHRK-VPFAWCAPESLKTRTF 330

  Fly  1238 TSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERID-TGYRMPTPKSTPEEMYRLMLQCWAADA 1301
            :...|.|.:|:.:||:|:.|..|:.|:..|:...:|| .|.|:..|:.:|:::|.:||||||...
 Frog   331 SHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLVRPEDSPQDIYNVMLQCWAHKP 395

  Fly  1302 ESRPHF 1307
            |.||.|
 Frog   396 EDRPTF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 96/261 (37%)
PTKc_Fes_like 1067..1315 CDD:270637 96/257 (37%)
tnk2XP_031757304.1 SAM_TNK-like 34..95 CDD:188938
PTKc_Ack_like 153..410 CDD:270636 96/257 (37%)
SH3_9 418..467 CDD:405311
GTPase_binding 472..533 CDD:401099
Inhibitor_Mig-6 883..947 CDD:402933
UBA_ACK1 1074..1115 CDD:270460
UBA_TNK1 1102..1141 CDD:270513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.