DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ripk3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_001343827.1 Gene:ripk3 / 100004555 ZFINID:ZDB-GENE-071115-4 Length:433 Species:Danio rerio


Alignment Length:272 Identity:78/272 - (28%)
Similarity:130/272 - (47%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 RIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICV--- 1129
            |:|.|.||.:::|:......|||||.  :...:.......:|..::....:.|:|:::|:..   
Zfish    23 RVGSGGFGQIFRARHTLWGTDVAVKL--LHYKEGSASSAQREAELMFDAGNSNVVRVLGVYEGRL 85

  Fly  1130 --QKQPIM--IVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLE--SKNCIHRDLAA 1188
              .::|:.  :|:|.:..|||...|::.:........:.|....:.||.:|.  :...:|.||..
Zfish    86 GDPQRPLQCGLVLEFLARGSLEDLLQRLAAPPPCALALRMALQVSLGMNFLHQLTPPILHLDLKP 150

  Fly  1189 RNCLVDLEHSVKISDFGMSREEEEYI----VSDGMKQIPVKWTAPEALNFGKY--TSLCDVWSYG 1247
            .|.|:......||:|||:||..|...    |:|..:...:.:..||||....|  :...||:|||
Zfish   151 SNVLLSDSLDAKITDFGLSRVAENVCKYTGVNDEDEGGTLSYMPPEALQSSSYKPSKAFDVYSYG 215

  Fly  1248 ILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTP-------EEMYRLMLQCWAADAESRP 1305
            ||:|.|.: |..||||:.:|..|.||..|.| |...|..       :|:.:||:|||..:...||
Zfish   216 ILLWSIIT-GKEPYSGVQSSLVRFRIPLGDR-PDLASVDCSETEGLDELLKLMMQCWDQEPHRRP 278

  Fly  1306 HFDEIYNVVDAL 1317
            .|.:..:.:.|:
Zfish   279 SFLDCVHAITAI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 77/264 (29%)
PTKc_Fes_like 1067..1315 CDD:270637 77/268 (29%)
ripk3XP_001343827.1 TyrKc 20..287 CDD:197581 77/267 (29%)
PKc_like 24..285 CDD:304357 76/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.