DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and AT1G51200

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001077694.1 Gene:AT1G51200 / 841543 AraportID:AT1G51200 Length:173 Species:Arabidopsis thaliana


Alignment Length:199 Identity:68/199 - (34%)
Similarity:100/199 - (50%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESNPMQP-MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIAIT 67
            :|.|..| :|.:.|||:|:.||..:||.|:||.|.:::|               ...|:.|::.|
plant     9 QSPPEGPKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQ---------------GAKFASAVSGT 58

  Fly    68 NTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAAS--ANEEDDKDKEDD 130
            :::.          |.:||..|.........:.|.:|.:..| :|.|..|.  |.||..|     
plant    59 SSSS----------NIIKETFTAALVDIETKSVEPMTVSVQP-SSVQVVAEVVAPEEAAK----- 107

  Fly   131 KDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEK 195
               .|..:||..|.|:||||||:||||.|:|..|||:|.|:|:|:|.....:.|.:.||||..||
plant   108 ---PKGPSRCTTCNKRVGLTGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANPVVKAEK 169

  Fly   196 IQKI 199
            :.||
plant   170 LDKI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 9/20 (45%)
rad23 37..>120 CDD:273167 14/84 (17%)
ZnF_AN1 140..177 CDD:197545 22/36 (61%)
AT1G51200NP_001077694.1 zf-A20 17..39 CDD:280010 10/21 (48%)
ZnF_AN1 114..150 CDD:197545 22/35 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I2060
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X652
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.