DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and AT1G12440

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001321241.1 Gene:AT1G12440 / 837801 AraportID:AT1G12440 Length:168 Species:Arabidopsis thaliana


Alignment Length:195 Identity:58/195 - (29%)
Similarity:89/195 - (45%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NPMQP-MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIAITNT 69
            :|.:| :|..||||:|:|:...|||.||:|....::|                 |.|...|:..:
plant    12 SPSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQ-----------------TASAKAAVEKS 59

  Fly    70 AQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKDKEDDKDAK 134
            ..|.....|...:   ::||           :.:..:...::||:...||....|       ..|
plant    60 LNPNKPKTQPQQS---QEIT-----------QGVLGSGSSSSSTRGGDSAAAPLD-------PPK 103

  Fly   135 KKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199
            ....||..|.||||:|||:||||..:|..|||.:.|.|.||::....:.|.:.||||..:|:.:|
plant   104 STATRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVAREAIAKANPVVKADKVDRI 168

  Fly   200  199
            plant   169  168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 10/20 (50%)
rad23 37..>120 CDD:273167 11/82 (13%)
ZnF_AN1 140..177 CDD:197545 21/36 (58%)
AT1G12440NP_001321241.1 zf-A20 18..39 CDD:396357 10/20 (50%)
ZnF_AN1 109..146 CDD:197545 21/36 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 111 1.000 Inparanoid score I2060
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.