DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and AT4G22820

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_194013.1 Gene:AT4G22820 / 828381 AraportID:AT4G22820 Length:176 Species:Arabidopsis thaliana


Alignment Length:196 Identity:69/196 - (35%)
Similarity:97/196 - (49%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESNPMQP-MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIAIT 67
            :|...:| :|..||||:|:|:...|||.||:....::.|..|:...|. .|.:|||..|..||  
plant    13 QSQASEPKLCVKGCGFFGSPSNMDLCSKCYRGICAEEAQTAVAKAAVE-KSFKPSPPRSLFIA-- 74

  Fly    68 NTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKDKEDDKD 132
              ..|.|....:|          |.||...|::|         .|:.|...|||         ..
plant    75 --EPPAVVVEPKP----------EKAAVVVVSAE---------PSSSAVPEANE---------PS 109

  Fly   133 AKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQ 197
            ...:.|||..|.||||:.||:|:||..:|..|||.:.|:|:||::|.|..||.:.||||..:|||
plant   110 RPARTNRCLCCNKKVGIMGFKCKCGSTFCGEHRYPETHDCSFDFKEVGRGEIAKANPVVKADKIQ 174

  Fly   198 K 198
            :
plant   175 R 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 10/20 (50%)
rad23 37..>120 CDD:273167 20/82 (24%)
ZnF_AN1 140..177 CDD:197545 19/36 (53%)
AT4G22820NP_194013.1 zf-A20 21..43 CDD:366793 11/21 (52%)
ZnF_AN1 117..154 CDD:197545 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 111 1.000 Inparanoid score I2060
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X652
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.