DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and SAP7

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_192941.1 Gene:SAP7 / 826812 AraportID:AT4G12040 Length:175 Species:Arabidopsis thaliana


Alignment Length:206 Identity:60/206 - (29%)
Similarity:96/206 - (46%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESN------PMQP-MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSP 58
            |..|.|      |.:| :|.:||||:|:|:...|||.||:....::.|..|:...|.      :.
plant     1 MGSEENNSTSFPPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVK------NS 59

  Fly    59 TFSPAIAITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEED 123
            ...|:.:|....|.....::..|                  .|.:.....|::...||       
plant    60 LKLPSCSIIAPGQKHPLEIKPAH------------------LETVVVTAEPSSVPVAA------- 99

  Fly   124 DKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNN 188
            ::|:.:.....:..|||..|.||||:.||:|:||..:|..|||.:||.|:||::|.|...|.:.|
plant   100 EQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKAN 164

  Fly   189 PVVVGEKIQKI 199
            |:|..:|:|:|
plant   165 PLVKADKVQRI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 10/20 (50%)
rad23 37..>120 CDD:273167 11/82 (13%)
ZnF_AN1 140..177 CDD:197545 20/36 (56%)
SAP7NP_192941.1 zf-A20 18..39 CDD:396357 10/20 (50%)
ZnF_AN1 116..153 CDD:197545 20/36 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 111 1.000 Inparanoid score I2060
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - LDO PTHR10634
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X652
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.