DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and AT3G52800

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001325951.1 Gene:AT3G52800 / 824446 AraportID:AT3G52800 Length:170 Species:Arabidopsis thaliana


Alignment Length:203 Identity:72/203 - (35%)
Similarity:101/203 - (49%) Gaps:50/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPP-------VSSTPVSVPSPQPSPTFS 61
            |||   .:|.:.|||.|:.||..|||.||.|...|:||..       .||..||.||...|...|
plant    11 ESN---RLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQSSSIKSTVESSLSVSPPSSSSSEISS 72

  Fly    62 PAIAITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKD 126
            |.|       |.:  |:.|  .||.::.|:.|..:.           |.|               
plant    73 PII-------PPL--LKNP--SVKLEVPEKKAVISL-----------PTT--------------- 100

  Fly   127 KEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVV 191
               :::.:::.|||..|||:||||||:||||.::|.||||.:.|.|::|::..|.:||.:.||:|
plant   101 ---EQNQQQRPNRCTTCRKRVGLTGFKCRCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANPLV 162

  Fly   192 VGEKIQKI 199
            ...|:|||
plant   163 KAAKLQKI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 10/20 (50%)
rad23 37..>120 CDD:273167 22/89 (25%)
ZnF_AN1 140..177 CDD:197545 22/36 (61%)
AT3G52800NP_001325951.1 zf-A20 14..36 CDD:396357 10/21 (48%)
ZnF_AN1 111..148 CDD:197545 22/36 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 111 1.000 Inparanoid score I2060
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.