DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and SAP5

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_566429.1 Gene:SAP5 / 820443 AraportID:AT3G12630 Length:160 Species:Arabidopsis thaliana


Alignment Length:198 Identity:62/198 - (31%)
Similarity:84/198 - (42%) Gaps:71/198 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIAITNTAQPTVT 75
            :|.:.||...||||:.:|..|:..||                                       
plant    25 LCTNNCGVTANPATNNMCQKCFNASL--------------------------------------- 50

  Fly    76 SLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKDK----EDDKDAKKK 136
                           .:|||..|.|.:|..        ::|.|.|......|    ..:.||.||
plant    51 ---------------VSAAAGVVESGSILK--------RSARSVNLRSSPAKVVIRPREIDAVKK 92

  Fly   137 K-----NRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKI 196
            :     |||..||||||||||:||||.|:|:.|||||:|:|::||:..|.:.|.|.||||...|:
plant    93 RDQQIVNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKM 157

  Fly   197 QKI 199
            .|:
plant   158 VKV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 8/20 (40%)
rad23 37..>120 CDD:273167 8/82 (10%)
ZnF_AN1 140..177 CDD:197545 25/36 (69%)
SAP5NP_566429.1 ZnF_AN1 101..138 CDD:197545 25/36 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I2060
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.