DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and Zfand6

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001347506.1 Gene:Zfand6 / 65098 MGIID:1929510 Length:223 Species:Mus musculus


Alignment Length:227 Identity:90/227 - (39%)
Similarity:128/227 - (56%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESNPMQ-PM-CRSGCGFYGNPATDGLCSVCYKDSLRKKQ------QPPVSSTPVSVPSPQPS 57
            |.:|:|..| || |.:||||||||.|:|:||||||:.|:::.      .||.:|.. |:....|.
Mouse     1 MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVS-SLSESLPV 64

  Fly    58 PTFSPAIAITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATG-------------- 108
            .....::....:|..:.:|..||.....:.:..|:.|.::|:|.::..|..              
Mouse    65 QCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSVDKAVSETEDLQGPRAEGLV 129

  Fly   109 ------PNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYS 167
                  |::.:......:||..|..|   ..|:|||||..||||||||||:||||.:||.|||||
Mouse   130 PLECDPPSSVSDTTQQPSEEQSKSLE---KPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYS 191

  Fly   168 DKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199
            |.|||:::|:...|::||:.||||||||||||
Mouse   192 DVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 15/21 (71%)
rad23 37..>120 CDD:273167 15/108 (14%)
ZnF_AN1 140..177 CDD:197545 26/36 (72%)
Zfand6NP_001347506.1 zf-A20 12..34 CDD:396357 15/21 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..155 18/114 (16%)
ZnF_AN1 164..201 CDD:197545 26/36 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9213
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 163 1.000 Inparanoid score I4197
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm42556
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - LDO PTHR10634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3781
SonicParanoid 1 1.000 - - X652
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.000

Return to query results.
Submit another query.