DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and zfand5

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001017128.1 Gene:zfand5 / 549882 XenbaseID:XB-GENE-966583 Length:211 Species:Xenopus tropicalis


Alignment Length:224 Identity:92/224 - (41%)
Similarity:123/224 - (54%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESN--PMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPA 63
            |.:|:|  |...:|.:||||||||.|:|:||||||:.|:::....:|  |:...|...||:...|
 Frog     1 MAQETNQTPGPMLCNTGCGFYGNPRTNGMCSVCYKEHLQRQNSGRIS--PMGAASGSNSPSAESA 63

  Fly    64 IAITNTAQPTVTSL----------QQPHN------DVKEKITE-------EAAAAAKVNSEAITS 105
                 |.|...|||          .:..|      .|.:::||       ..|:.....||.:.:
 Frog    64 -----TVQRVETSLNCEGAAGGLSDKSRNTPLAALPVTQQMTEMSISREDHVASPKTETSEPVVT 123

  Fly   106 ATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKH 170
            ...|:.| |.:.|.|||...:.     .|.|||||..||||:|||||.||||.|:|.:|||||||
 Frog   124 QPSPSVS-QPSTSLNEEKAPEL-----PKPKKNRCFMCRKKIGLTGFDCRCGNLFCGLHRYSDKH 182

  Fly   171 NCTFDYREHGAQEIRRNNPVVVGEKIQKI 199
            ||.:||:...|.:||:.|||||.||||:|
 Frog   183 NCPYDYKAEAAAKIRKENPVVVAEKIQRI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 14/20 (70%)
rad23 37..>120 CDD:273167 22/105 (21%)
ZnF_AN1 140..177 CDD:197545 26/36 (72%)
zfand5NP_001017128.1 zf-A20 12..35 CDD:280010 15/22 (68%)
ZnF_AN1 152..189 CDD:197545 26/36 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9081
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4081
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm47657
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3781
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.