DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and ZFAND6

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001229840.1 Gene:ZFAND6 / 54469 HGNCID:30164 Length:208 Species:Homo sapiens


Alignment Length:209 Identity:88/209 - (42%)
Similarity:130/209 - (62%) Gaps:11/209 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESNPMQ-PM-CRSGCGFYGNPATDGLCSVCYKDSLRKKQ------QPPVSSTPVSVPSPQPS 57
            |.:|:|..| || |.:||||||||.|:|:||||||:.|:::.      .||.:|.. |:....|.
Human     1 MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVS-SLSESLPV 64

  Fly    58 PTFSPAIAITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAAS--AN 120
            .....::....:|..:.:|..||.....:.:..|:.|:::::|.::..|.......||:.|  |.
Human    65 QCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQ 129

  Fly   121 EEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIR 185
            :..::..:..:..|:|||||..||||||||||:||||.:||.||||||.|||:::|:...|::||
Human   130 QPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIR 194

  Fly   186 RNNPVVVGEKIQKI 199
            :.||||||||||||
Human   195 KENPVVVGEKIQKI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 15/21 (71%)
rad23 37..>120 CDD:273167 16/90 (18%)
ZnF_AN1 140..177 CDD:197545 26/36 (72%)
ZFAND6NP_001229840.1 zf-A20 12..35 CDD:307735 16/22 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..140 17/99 (17%)
ZnF_AN1 149..186 CDD:197545 26/36 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9276
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 172 1.000 Inparanoid score I4096
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm40480
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - LDO PTHR10634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3781
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.