DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and zfand6

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_989034.1 Gene:zfand6 / 394631 XenbaseID:XB-GENE-950123 Length:201 Species:Xenopus tropicalis


Alignment Length:217 Identity:91/217 - (41%)
Similarity:131/217 - (60%) Gaps:34/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESNPMQP--MCRSGCGFYGNPATDGLCSVCYKDSLRK-----KQQPPV--------SSTPVS 50
            |.:|:|..|.  :|.:||||||||.|:||||||||:.|::     :..|||        .|||.:
 Frog     1 MAQETNHSQAPLLCSTGCGFYGNPRTNGLCSVCYKEHLQRQNSGGRNSPPVVSVGSGVEVSTPQN 65

  Fly    51 VPSPQPSPTFSPAIAITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKV-NSEAITSATG--PNTS 112
            ..|.|......|.:..|..|    :||         .:.|..:::::. |:|:.|:.|.  |..:
 Frog    66 AESSQAGGVADPVVPQTTQA----SSL---------PLLETGSSSSQAENAESRTTDTKEIPAAT 117

  Fly   113 TQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYR 177
            :.:|.:::||.::..|   .||.|||||..||||:|||||:||||.::|..|||||.|:|::||:
 Frog   118 SDSAQNSSEEQERSPE---KAKLKKNRCFMCRKKIGLTGFECRCGNVFCGTHRYSDVHSCSYDYK 179

  Fly   178 EHGAQEIRRNNPVVVGEKIQKI 199
            ...|::||:.||||||||||||
 Frog   180 ADAAEKIRKENPVVVGEKIQKI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 15/20 (75%)
rad23 37..>120 CDD:273167 20/98 (20%)
ZnF_AN1 140..177 CDD:197545 23/36 (64%)
zfand6NP_989034.1 zf-A20 12..35 CDD:307735 16/22 (73%)
ZnF_AN1 142..179 CDD:197545 23/36 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9081
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 164 1.000 Inparanoid score I4081
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm47657
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3781
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.