DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and zfand6

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001315498.1 Gene:zfand6 / 336461 ZFINID:ZDB-GENE-030131-8405 Length:232 Species:Danio rerio


Alignment Length:244 Identity:88/244 - (36%)
Similarity:127/244 - (52%) Gaps:57/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIA 65
            |.:|:|..|.:|.:||||||||..:|:|||||||||:::.....||.|||      |...|...:
Zfish     1 MAQETNQTQVLCSNGCGFYGNPRNNGMCSVCYKDSLQRQNNSGRSSDPVS------SSLSSKGES 59

  Fly    66 ITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNT---------------STQ- 114
            :      ||.|..|...:.:..:|...||....:..::.:.:|..|               ||: 
Zfish    60 L------TVQSTSQHEQNSQRFLTSTPAAVTHKDGASVAAPSGQKTPEVQCSKLKRSSLESSTEK 118

  Fly   115 -----------------------------AAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLT 150
                                         .:|||:...::..::.:.:|.|||||..||||||||
Zfish   119 QLTARSPSLEESTSRGKRKLDETCQPVETVSASASSVSEQTSDEPEQSKPKKNRCFTCRKKVGLT 183

  Fly   151 GFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199
            ||.||||.|:|.:|||||.|:|:|||:...|::||:.||::|||||:||
Zfish   184 GFDCRCGQLFCGIHRYSDVHSCSFDYKADAAEKIRKENPLIVGEKIKKI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 13/20 (65%)
rad23 37..>120 CDD:273167 20/127 (16%)
ZnF_AN1 140..177 CDD:197545 26/36 (72%)
zfand6NP_001315498.1 zf-A20 10..33 CDD:280010 14/22 (64%)
ZnF_AN1 173..210 CDD:197545 26/36 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8880
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10372
Inparanoid 1 1.050 163 1.000 Inparanoid score I4183
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm26264
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - LDO PTHR10634
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.