DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and CG15368

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster


Alignment Length:123 Identity:55/123 - (44%)
Similarity:72/123 - (58%) Gaps:12/123 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGE 142
            |||.....:...||.      :|.|:.|..|......:|.|..::|....:|     ..|.||.:
  Fly    51 QQPQQQQDQPPMEEQ------DSRAVNSKDGAANQDTSADSGQDQDGNQAQD-----STKKRCDK 104

  Fly   143 CRKKVGLT-GFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199
            |.||:|:| ||.|||||.|||||||||:|.|.||||:.||.:|||:|||||..|::|:
  Fly   105 CGKKLGITGGFPCRCGGTYCAVHRYSDRHECNFDYRQMGAIQIRRDNPVVVASKLRKL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357
rad23 37..>120 CDD:273167 11/41 (27%)
ZnF_AN1 140..177 CDD:197545 26/37 (70%)
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 26/37 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm2779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10634
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.