DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and Zfand5

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_033577.1 Gene:Zfand5 / 22682 MGIID:1278334 Length:213 Species:Mus musculus


Alignment Length:229 Identity:92/229 - (40%)
Similarity:122/229 - (53%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESN--PMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFS-- 61
            |.:|:|  |...:|.:||||||||.|:|:||||||:.| ::||.....:|:...|...|||..  
Mouse     1 MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHL-QRQQNSGRMSPMGTASGSNSPTSDSA 64

  Fly    62 --------------------------PAIAITNTAQPTVTSLQQPHNDVKEKITEEAAAAAKVNS 100
                                      |..|:..|.|.|..|:.:     ::|||......    |
Mouse    65 SVQRADAGLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISR-----EDKITTPKTEV----S 120

  Fly   101 EAITSATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHR 165
            |.:.:...|:.| |.::|.:||...:.     .|.|||||..||||||||||.||||.|:|.:||
Mouse   121 EPVVTQPSPSVS-QPSSSQSEEKAPEL-----PKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHR 179

  Fly   166 YSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199
            |||||||.:||:...|.:||:.|||||.||||:|
Mouse   180 YSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 14/20 (70%)
rad23 37..>120 CDD:273167 22/110 (20%)
ZnF_AN1 140..177 CDD:197545 27/36 (75%)
Zfand5NP_033577.1 zf-A20 12..35 CDD:366793 15/22 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..149 24/124 (19%)
ZnF_AN1 154..191 CDD:197545 27/36 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847752
Domainoid 1 1.000 73 1.000 Domainoid score I9213
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4197
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - otm42556
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3781
SonicParanoid 1 1.000 - - X652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.