DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and Zfand3

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001343194.1 Gene:Zfand3 / 21769 MGIID:1096572 Length:227 Species:Mus musculus


Alignment Length:223 Identity:64/223 - (28%)
Similarity:103/223 - (46%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIAI 66
            ||...|..|. |..|||:|:..|..|||.|:.|.  :|:||...|||.:  |...|..||.....
Mouse     7 ERSKAPSLPP-RCPCGFWGSSKTMNLCSKCFADF--QKKQPDDDSTPST--SNSQSDLFSEETTS 66

  Fly    67 ----TNTAQPTVTSLQQ---PHNDVKEKITEEAAAAAKVNSEAITSAT----GPNTSTQAAAS-- 118
                |:...||::..||   ...:|....|||..........::.:.|    |.::.::..||  
Mouse    67 DNNNTSVTTPTLSPSQQSLPTELNVTSPSTEECGPCTDTAHVSLITPTKRSCGADSQSENEASPV 131

  Fly   119 ----ANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQ---CRCGGLYCAVHRYSDKHNCTFDY 176
                ..|..::.:|..:..:|.:.||.:|:.|:.|...:   ||||.::|.:||..::|:||||:
Mouse   132 KRPRLVENPERPEESGRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDH 196

  Fly   177 REHGAQE-----IRRNNPVVVGEKIQKI 199
            ...|.:|     ::.:..  ||...|:|
Mouse   197 MGRGREEAIMKMVKLDRK--VGRSCQRI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 9/20 (45%)
rad23 37..>120 CDD:273167 23/99 (23%)
ZnF_AN1 140..177 CDD:197545 16/39 (41%)
Zfand3NP_001343194.1 zf-A20 <19..36 CDD:366793 8/16 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..99 18/59 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..151 6/37 (16%)
zf-AN1 <174..194 CDD:376545 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.