DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and F56F3.4

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_497908.1 Gene:F56F3.4 / 186395 WormBaseID:WBGene00010155 Length:341 Species:Caenorhabditis elegans


Alignment Length:165 Identity:48/165 - (29%)
Similarity:76/165 - (46%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RKKQQPPVSSTPV--SVPSPQPSPTFSPA------IAITNTAQPTVTSLQQPHNDVKEKITEEAA 93
            |||..|.:|.|||  .:.|.|   ||||.      ::..:|....|:|..:|.:|. |.:||:..
 Worm   171 RKKHAPILSGTPVDSEIGSAQ---TFSPVATPPGELSSPSTVSSHVSSGSEPESDA-EVVTEKEL 231

  Fly    94 AAAKVNSEAITSATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLT--GFQCRC 156
            .......|.|........|...|.|:.||..::.:  |...::|.:|..|.||:...  ...|:|
 Worm   232 KLFFDPPETIEEHKQCRRSMVLAPSSEEELLENLK--KFEAERKTKCNTCFKKLSAAQQTMHCKC 294

  Fly   157 GGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVV 191
            ..::|..||:...|.|..||::.|..::::||..|
 Worm   295 LRIFCDRHRHPKNHTCVIDYKQDGRNKLKKNNSKV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357
rad23 37..>120 CDD:273167 27/90 (30%)
ZnF_AN1 140..177 CDD:197545 12/38 (32%)
F56F3.4NP_497908.1 UBQ 22..94 CDD:214563
ubiquitin 32..96 CDD:278661
ZnF_AN1 276..315 CDD:197545 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - O PTHR10634
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.