DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and rabx-5

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001360492.1 Gene:rabx-5 / 176481 WormBaseID:WBGene00012644 Length:520 Species:Caenorhabditis elegans


Alignment Length:201 Identity:48/201 - (23%)
Similarity:77/201 - (38%) Gaps:51/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESNPMQPMCRSGCGFYGNPATDGLCSVCYK---DSLRKKQQPPVSSTPVSVPSPQ---PSPT 59
            |..::|.:  :|.:||||||.|..:..||.|::   :.::|.|....:.:.:|....|   .|.|
 Worm    14 MHLKANDL--LCVNGCGFYGTPQWENRCSKCWRAHQNEMKKCQDFAKNRSLLSFDQFQERRKSTT 76

  Fly    60 FSPAIAITN-----------TAQPTVTS-LQQP--HNDVKEKITEEAAAAAKVNSEAITSATGPN 110
            .|.:..|.|           |:.||.|| ...|  |:..:|...:...|     .:..|.....|
 Worm    77 ESKSRGIKNLFKTSPIPEGGTSSPTSTSPASTPTRHSRRRELSPDSLEA-----RQQFTDFLVAN 136

  Fly   111 TSTQAAASANEEDDKDKEDDKDAKKKKNRCGECR------KKVGLTGFQC---RCGGLYCAVHRY 166
            .||..|          :|..:..|...|:..|.|      .::.::.:|.   |.||     |..
 Worm   137 LSTGMA----------QEIARSVKNAVNKISEMRMSSDDMSELVMSYYQYLGERIGG-----HSL 186

  Fly   167 SDKHNC 172
            .|..:|
 Worm   187 FDSPDC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 10/20 (50%)
rad23 37..>120 CDD:273167 23/99 (23%)
ZnF_AN1 140..177 CDD:197545 9/42 (21%)
rabx-5NP_001360492.1 zf-A20 21..44 CDD:366793 11/24 (46%)
DUF5601 147..212 CDD:375592 11/51 (22%)
VPS9 259..361 CDD:366977
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.