DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45050 and F22D6.2

DIOPT Version :9

Sequence 1:NP_001027161.1 Gene:CG45050 / 41114 FlyBaseID:FBgn0266410 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001369930.1 Gene:F22D6.2 / 172441 WormBaseID:WBGene00009050 Length:189 Species:Caenorhabditis elegans


Alignment Length:212 Identity:80/212 - (37%)
Similarity:112/212 - (52%) Gaps:36/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERESNPMQ--PMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPA 63
            ||.|....|  |.||:||||:|..||:|.||.|:|::|:::|.....::||..||         :
 Worm     1 MENEQQQAQTAPSCRAGCGFFGASATEGYCSQCFKNTLKRQQDTVRLTSPVVSPS---------S 56

  Fly    64 IAITNTAQPTVTSLQQPHNDVKEKITEEAA---------AAAKVNSEAITSA--TGPNTSTQAAA 117
            :|.|::|..:..|...........:::|.|         ...::|.:::|.|  |.|.|.|    
 Worm    57 MAATSSALKSEPSSVDMCMKAAVSVSDETAKMDCEDIINVCDQINDDSVTVAESTAPTTIT---- 117

  Fly   118 SANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQ 182
                      .|.....||.|||..|:|:||||||.||||||||..|||...|||.|||:....:
 Worm   118 ----------VDVPVPVKKANRCHMCKKRVGLTGFSCRCGGLYCGDHRYDQAHNCQFDYKTMERE 172

  Fly   183 EIRRNNPVVVGEKIQKI 199
            .||:||||||.:|:|:|
 Worm   173 TIRKNNPVVVSDKVQRI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45050NP_001027161.1 zf-A20 11..32 CDD:396357 12/20 (60%)
rad23 37..>120 CDD:273167 18/93 (19%)
ZnF_AN1 140..177 CDD:197545 25/36 (69%)
F22D6.2NP_001369930.1 zf-A20 14..34 CDD:396357 12/19 (63%)
ZnF_AN1 130..167 CDD:197545 25/36 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167009
Domainoid 1 1.000 69 1.000 Domainoid score I6343
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I3089
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000916
OrthoInspector 1 1.000 - - oto20255
orthoMCL 1 0.900 - - OOG6_101508
Panther 1 1.100 - - LDO PTHR10634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3781
SonicParanoid 1 1.000 - - X652
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.